Basic Information | |
---|---|
Taxon OID | 3300010944 Open in IMG/M |
Scaffold ID | Ga0138501_111955 Open in IMG/M |
Source Dataset Name | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate Ab1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Autonomous University of Barcelona |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1014 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alicante,Spain | |||||||
Coordinates | Lat. (o) | 38.34 | Long. (o) | -0.48 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003622 | Metagenome / Metatranscriptome | 476 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0138501_1119553 | F003622 | N/A | MRTYNKELEIIASDILDQNAEAIGNENKPNYTNREFMNCLIIFQTALMDKMYDNQEYDKMSIEDRSNMATRCGLDLRKLIHTYTGLDTHQIENFL* |
⦗Top⦘ |