| Basic Information | |
|---|---|
| Taxon OID | 3300010943 Open in IMG/M |
| Scaffold ID | Ga0138502_105979 Open in IMG/M |
| Source Dataset Name | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate Ab2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Autonomous University of Barcelona |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1396 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alicante,Spain | |||||||
| Coordinates | Lat. (o) | 38.34 | Long. (o) | -0.48 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079658 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138502_1059793 | F079658 | N/A | YADFEEVASVSRARLFVTAAKRWLILRAESASNQSSSLSIGKSFVENLLKRAEAYVAANATASSGANSRTRFLHVGSYFR* |
| ⦗Top⦘ |