Scaffold Ga0138503_100059

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138503_100059

Scaffold Ga0138503_100059

Overview

Basic Information
Taxon OID	3300010941 Open in IMG/M
Scaffold ID	Ga0138503_100059 Open in IMG/M
Source Dataset Name	Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate Ab3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Autonomous University of Barcelona
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9094
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (15.38%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain

Source Dataset Sampling Location
Location Name	Alicante,Spain
Coordinates	Lat. (^o)	38.34	Long. (^o)	-0.48	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013948	Metagenome / Metatranscriptome	267	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138503_1000594	F013948	N/A	MRERIKKIRAYIFRGWEDEPTKPHPRLKILPPFFFELLAYLIGLSILYQIGAYLWSII*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.