Scaffold Ga0137716_10037859

Overview

Basic Information

• Taxon OID: 3300010938
• Scaffold ID: Ga0137716_10037859
• Source Dataset Name: Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5416
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment → Sediment Core Sample Microbial Community From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7101
  • Long. (^o): -110.7413
  • Depth (m): .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014385	Metagenome / Metatranscriptome	263	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137716_100378592	F014385	GGCGG	VIHSESPDWWQLTQLVCVRMALEQLTPEEERALWLYAEGATLSPKQRTLAETALQKIRRMLGLE*