NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137716_10005901

Scaffold Ga0137716_10005901


Overview

Basic Information
Taxon OID3300010938 Open in IMG/M
Scaffold IDGa0137716_10005901 Open in IMG/M
Source Dataset NameSediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)26972
Total Scaffold Genes33 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (69.70%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment → Sediment Core Sample Microbial Community From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameChocolate Pots hot springs, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7101Long. (o)-110.7413Alt. (m)Depth (m).01
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014829Metagenome / Metatranscriptome259Y

Sequences

Protein IDFamilyRBSSequence
Ga0137716_1000590116F014829N/AMQPVRVRERIAGTLHQYVGLRAGAGWAQDSLRGAASLSGRRKFNKFFYDGELVLRYPVRAGVGSVIPYVLGGAGAVTLHRLDTSTSEDFTKFAGNFGAGLEYRYQRIGVRAEGRDLVYKFDRFGFDKTQHGIVWDAGVTVSF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.