| Basic Information | |
|---|---|
| Taxon OID | 3300010938 Open in IMG/M |
| Scaffold ID | Ga0137716_10000005 Open in IMG/M |
| Source Dataset Name | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 490849 |
| Total Scaffold Genes | 768 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 505 (65.76%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | (Source: IMG-VR) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment → Sediment Core Sample Microbial Community From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.7101 | Long. (o) | -110.7413 | Alt. (m) | Depth (m) | .01 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096147 | Metagenome | 105 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137716_10000005707 | F096147 | N/A | MSVEALKKNFVPKYLATGEQKFYRFLILYALNKLIYIEKGSFKGKSPELEFLDYYDQFIILYRREGEDVYLELARVFRKAAHKVYRVMLKKNMTERNAKFLNLV* |
| ⦗Top⦘ |