| Basic Information | |
|---|---|
| Taxon OID | 3300010937 Open in IMG/M |
| Scaffold ID | Ga0137776_1590622 Open in IMG/M |
| Source Dataset Name | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Minnesota - Twin Cities |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 767 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Dco-Ecs Fumarole Sampling, Azores 2015 |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Furnas, Sao Miguel | |||||||
| Coordinates | Lat. (o) | 37.772747 | Long. (o) | -25.304072 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005005 | Metagenome / Metatranscriptome | 415 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137776_15906221 | F005005 | N/A | PKQKFSYTFQTPGTYGFEDELHPKLTGKVTVKAAPPTLTLGVSQSTVVYGTKVTLSGTISSHAAGQQVTIYYRPYPQPNLIQRTTLLTATGGTFSFIVEPQVLTTYQASWSGAYATPLNVQVQPHLSLGKSGAWLIHVSGGRSFAGRSVQLQRLNVDTGQWVTLRKVQLNSKSSARVSVTLPKGVDKLRLTMSVNQAGAGYLGVVGPTVTWRQT* |
| ⦗Top⦘ |