NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137776_1077077

Scaffold Ga0137776_1077077


Overview

Basic Information
Taxon OID3300010937 Open in IMG/M
Scaffold IDGa0137776_1077077 Open in IMG/M
Source Dataset NameFumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Minnesota - Twin Cities
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)554
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Dco-Ecs Fumarole Sampling, Azores 2015

Source Dataset Sampling Location
Location NameFurnas, Sao Miguel
CoordinatesLat. (o)37.772747Long. (o)-25.304072Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019937Metagenome226Y

Sequences

Protein IDFamilyRBSSequence
Ga0137776_10770771F019937AGGAMMGRPPRVPVDLQAVTRDVKAQVRRVLGELDAIEQQQDPIFASPRDVFLELVLSIHELEAAAAKMRKAWWPPP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.