Scaffold Ga0137784_1443814

Overview

Basic Information

• Taxon OID: 3300010936
• Scaffold ID: Ga0137784_1443814
• Source Dataset Name: Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hawaii
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1135
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Surface Seawater Of North Pacific Subtropical Gyre - Stn. Aloha, 15M

Source Dataset Sampling Location

• Location Name: North Pacific Subtropical Gyre
• Coordinates
  • Lat. (^o): 22.75
  • Long. (^o): -158.0
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023961	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137784_14438142	F023961	GAGG	MSNYIETDMKHDKEFFKKYINGKWEDSNKLYKEYMSWENRKFFVQEIKDFDRPLLRKMKEIWNYLGIRPRDFRCNFFRVLPGGELPLHTDVLSKSSVVIPITEMTGPLYFDDGTEVLYQNMTVINTKKAHGVKA