NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137784_1395921

Scaffold Ga0137784_1395921


Overview

Basic Information
Taxon OID3300010936 Open in IMG/M
Scaffold IDGa0137784_1395921 Open in IMG/M
Source Dataset NameMarine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2429
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Surface Seawater Of North Pacific Subtropical Gyre - Stn. Aloha, 15M

Source Dataset Sampling Location
Location NameNorth Pacific Subtropical Gyre
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041260Metagenome160N

Sequences

Protein IDFamilyRBSSequence
Ga0137784_13959213F041260N/AMACRSTILIDNFLSASDFNSISSRVSASEQYNHANHHDMRDELWTDVTNLVFNRMREINLYQTHFEEASKIASFSYNQFRPPNYGHGNMYGPHVDNGSYVLYIHPDWNENWEGKIKITDAVESKYREGIFAKPNRFIWMNPTVKHDISTTSSDAGHARVTNLGFLGATLTNDPTGVEYINIFTE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.