Basic Information | |
---|---|
Taxon OID | 3300010936 Open in IMG/M |
Scaffold ID | Ga0137784_1007789 Open in IMG/M |
Source Dataset Name | Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Hawaii |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 790 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Surface Seawater Of North Pacific Subtropical Gyre - Stn. Aloha, 15M |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pacific Subtropical Gyre | |||||||
Coordinates | Lat. (o) | 22.75 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 15 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103354 | Metagenome / Metatranscriptome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137784_10077891 | F103354 | N/A | DAVTTETKKTVNESRSFASKPTGNAPKKPIVESNDFVSRMQKLAGII* |
⦗Top⦘ |