| Basic Information | |
|---|---|
| Taxon OID | 3300010934 Open in IMG/M |
| Scaffold ID | Ga0137844_1178355 Open in IMG/M |
| Source Dataset Name | Microbial mat microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV9-P3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Hellenic Centre for Marine Research (HCMR) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 812 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool Microbial Mat → Kallisti Limnes Metagenome Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Santorini, Greece | |||||||
| Coordinates | Lat. (o) | 36.4542567 | Long. (o) | 25.40523 | Alt. (m) | Depth (m) | 229 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080499 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137844_11783552 | F080499 | AGGAG | MTKVTKEMIENWLGTDTDIPELLSELANGEYEQETFRDDVIGTCQEENDDE* |
| ⦗Top⦘ |