Scaffold Ga0137844_1149524

Overview

Basic Information

• Taxon OID: 3300010934
• Scaffold ID: Ga0137844_1149524
• Source Dataset Name: Microbial mat microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV9-P3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Hellenic Centre for Marine Research (HCMR)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 878
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool Microbial Mat → Kallisti Limnes Metagenome Study

Source Dataset Sampling Location

• Location Name: Santorini, Greece
• Coordinates
  • Lat. (^o): 36.4542567
  • Long. (^o): 25.40523
  • Depth (m): 229

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073647	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137844_11495241	F073647	AGGAGG	MSNVPKDIHKALGIMLKYKLINEAGMSAYLAKYIRRDNTPRVIQLPKPREATAALEKTLMDVVNRQGNQAFTVSEITQKVEAMVGKTTDSAVRYVLGLMVQKGKAEQIHADGRVXFGXKX