Scaffold Ga0137844_1138595

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137844_1138595

Scaffold Ga0137844_1138595

Overview

Basic Information
Taxon OID	3300010934 Open in IMG/M
Scaffold ID	Ga0137844_1138595 Open in IMG/M
Source Dataset Name	Microbial mat microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV9-P3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Hellenic Centre for Marine Research (HCMR)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1145
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool Microbial Mat → Kallisti Limnes Metagenome Study

Source Dataset Sampling Location
Location Name	Santorini, Greece
Coordinates	Lat. (^o)	36.4542567	Long. (^o)	25.40523	Alt. (m)		Depth (m)	229
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011088	Metagenome / Metatranscriptome	295	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137844_11385953	F011088	N/A	MTFIVPEYTCKHPIFPHYNTVDLMYDALNNGCEXXXWYAYLDFISDNQFDFGGG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.