Scaffold Ga0137843_1149309

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137843_1149309

Scaffold Ga0137843_1149309

Overview

Basic Information
Taxon OID	3300010932 Open in IMG/M
Scaffold ID	Ga0137843_1149309 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Hellenic Centre for Marine Research (HCMR)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	695
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool → Kallisti Limnes Metagenome Study

Source Dataset Sampling Location
Location Name	Santorini, Greece
Coordinates	Lat. (^o)	36.45421	Long. (^o)	25.40539	Alt. (m)		Depth (m)	229
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097164	Metagenome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137843_11493091	F097164	N/A	NSIVQAEKYFDWRNNGLKQEWKSKNIYLYPPRDVSLKSEQPKSDLLFTKISYFKKSNQRVWLETAYKKWLKREFNEGIILLTSSEVALISMQKIGIDLPMCILKEHPRLLEDNKKLKPXKHSKVFGFVFYMPPIQDYQTRIHDFHRQYSDLGRVYL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.