| Basic Information | |
|---|---|
| Taxon OID | 3300010932 Open in IMG/M |
| Scaffold ID | Ga0137843_1111063 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Hellenic Centre for Marine Research (HCMR) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 594 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool → Kallisti Limnes Metagenome Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Santorini, Greece | |||||||
| Coordinates | Lat. (o) | 36.45421 | Long. (o) | 25.40539 | Alt. (m) | Depth (m) | 229 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052636 | Metagenome | 142 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137843_11110632 | F052636 | AGGA | MNKTINIGEGQNNVEIHQTIAKPDKGPSVGGVSLTTGYGWGVDVSXILVXVALMXIGKKCVDKWALK* |
| ⦗Top⦘ |