| Basic Information | |
|---|---|
| Taxon OID | 3300010919 Open in IMG/M |
| Scaffold ID | Ga0137660_10492 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS4_55_TP1_12H |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1188 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Marker 113, Axial Seamount, Northeast Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 45.922741 | Long. (o) | -129.988104 | Alt. (m) | Depth (m) | 1522 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042865 | Metagenome / Metatranscriptome | 157 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137660_104922 | F042865 | AGGCGG | MSLRVPDYETFLAADDFNKRIWWQFMQSVVNDLPLNGNVAPENTIHANKSCLYVESTGGSAVLWFNPNGNGSATGWIVK* |
| ⦗Top⦘ |