Scaffold Ga0133913_11406482

Overview

Basic Information

• Taxon OID: 3300010885
• Scaffold ID: Ga0133913_11406482
• Source Dataset Name: northern Canada Lakes Co-assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1774
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Croche, Canada
• Coordinates
  • Lat. (^o): 46.8319
  • Long. (^o): -72.5
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028171	Metagenome / Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133913_114064827	F028171	N/A	EALISDSGMFHAGQQDERLRLCRLIDIRLNDLGKLGRGPIISARLEELLHIRQALRDHP*