Scaffold Ga0133547_11448845

Overview

Basic Information

• Taxon OID: 3300010883
• Scaffold ID: Ga0133547_11448845
• Source Dataset Name: western Arctic Ocean co-assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1292
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Zambryskibacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean: Canada Basin
• Coordinates
  • Lat. (^o): 79.2466
  • Long. (^o): -150.0613
  • Depth (m): 190

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091848	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133547_114488452	F091848	GGA	MSTQTEILDNVLGVTDVIGTTTREVTIPRPVLVPKTDE