Scaffold Ga0126344_1286127

Overview

Basic Information

• Taxon OID: 3300010866
• Scaffold ID: Ga0126344_1286127
• Source Dataset Name: Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 569
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil → Forest Soil Eukaryotic Communities From Alaska, Usa, For A Soil Warming Experiment In A Boreal Forest

Source Dataset Sampling Location

• Location Name: Alaska, USA
• Coordinates
  • Lat. (^o): 63.883
  • Long. (^o): -145.733

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004096	Metagenome / Metatranscriptome	453	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126344_12861272	F004096	GAG	MRNFEFLAAAWMMVWAIFFGYELSVASRVAALRRDIEELKRQLEEK*