Scaffold Ga0126346_1357311

Overview

Basic Information

• Taxon OID: 3300010865
• Scaffold ID: Ga0126346_1357311
• Source Dataset Name: Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 681
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil → Forest Soil Eukaryotic Communities From Alaska, Usa, For A Soil Warming Experiment In A Boreal Forest

Source Dataset Sampling Location

• Location Name: Alaska, USA
• Coordinates
  • Lat. (^o): 63.883
  • Long. (^o): -145.733

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035881	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126346_13573112	F035881	GGA	MAPMEESRLNYERQRRSLNARLGLMVFALLPLPAILIAVGLSPLRMLLVVASLGVSIGILYPLWWRTKHNPLRAWVVERRTRRIAWICRPSGFLCGIAAMLSWSVGTEAAEWVAFAFAAAAFLLLWFSRFSDRKAEQELRSARPTIQVREGLKE*