Scaffold Ga0126357_1303374

Overview

Basic Information

• Taxon OID: 3300010864
• Scaffold ID: Ga0126357_1303374
• Source Dataset Name: Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 633
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil → Forest Soil Eukaryotic Communities From Alaska, Usa, For A Soil Warming Experiment In A Boreal Forest

Source Dataset Sampling Location

• Location Name: Alaska, USA
• Coordinates
  • Lat. (^o): 63.883
  • Long. (^o): -145.733

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059208	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126357_13033742	F059208	N/A	LSKREVSMGLVELLLIVLVIAAIAGGIGVSPFLWLLLLVAVVILLTGGGFGYRRGGRV*