NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0124850_1002525

Scaffold Ga0124850_1002525


Overview

Basic Information
Taxon OID3300010863 Open in IMG/M
Scaffold IDGa0124850_1002525 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5393
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000936Metagenome / Metatranscriptome828Y
F003372Metagenome / Metatranscriptome491Y
F021388Metagenome / Metatranscriptome219N
F053645Metagenome / Metatranscriptome141N

Sequences

Protein IDFamilyRBSSequence
Ga0124850_100252510F003372N/ALRSPLKRDAELRPHSLLAAPAVKREAEEDWGKMAITQGKMPFVFGMVVLATLLVAAPAAHSACRSPKNICKHFDDCLLRTSDPNNKDADGIRAGVTARNGQIVLASAETCARDLGRKQQWDKWARGCSELEFVQIAKVGLELGKVHCDRYSQ*
Ga0124850_10025254F000936GGGGGMNHAQKYLAQANRHIAELVVQIAHQRAIIKALETGQGSEMAESLLDALQASLRIFEKHRVLILGQLQRQRSE*
Ga0124850_10025255F053645GGAGGMKKLAILGIIGGAAILTAAPLSLQWSQKNVALSLDSAKAGTATSGVSRRVHRKVYRRAAYGTAVAGSGGYGYNSLANCGGGYLAYGTSYVAPCGQYSSSYAIAEERLKAGYSVAPYSYYGPSSSYRRPSRY*
Ga0124850_10025257F021388GAGMRIKRTPNDAGTKLTIEFAYYDNGFVSINGSPKGDYTPDEAERWLASTRFVMQMIEEFRNYINKSKTSAAA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.