| Basic Information | |
|---|---|
| Taxon OID | 3300010429 Open in IMG/M |
| Scaffold ID | Ga0116241_11029116 Open in IMG/M |
| Source Dataset Name | AD_USRAca |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 624 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA | |||||||
| Coordinates | Lat. (o) | 40.3 | Long. (o) | -88.15 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069822 | Metagenome / Metatranscriptome | 123 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116241_110291161 | F069822 | N/A | LFNMFKLLDNKWRNSIINELQDHIGKNKNSKDIKNRNIYEGTEIEFTHEDQIGEIKLFTGVVTETNYEESTFVVDSYENFYTVDISSITKILNNSKFKYNLNKLNNIDFL* |
| ⦗Top⦘ |