Scaffold Ga0116241_10117543

Overview

Basic Information

• Taxon OID: 3300010429
• Scaffold ID: Ga0116241_10117543
• Source Dataset Name: AD_USRAca
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2280
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_53_11 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 40.3
  • Long. (^o): -88.15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042757	Metagenome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116241_101175432	F042757	GGA	VRNRKVNEALIQGVKTARAILTTTPQGQAADAQFVKWLMDHQKEAGVFTTVSGLVEQLTDNPAAKMTAQEIAQRVQQAQKQPAGAV*