| Basic Information | |
|---|---|
| Taxon OID | 3300010412 Open in IMG/M |
| Scaffold ID | Ga0136852_12128970 Open in IMG/M |
| Source Dataset Name | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 527 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mai Po Marshes at Hong Kong | |||||||
| Coordinates | Lat. (o) | 22.0 | Long. (o) | 114.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082881 | Metagenome / Metatranscriptome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136852_121289702 | F082881 | N/A | AGMQAGIEATLGQLAPGNVADQFEQGRARTLAPGQDPRPKYWEHYAEFYRVITQHRGSNGLPHPFAEAFGAAYTQKRDELRASRRSREDGSD* |
| ⦗Top⦘ |