| Basic Information | |
|---|---|
| Taxon OID | 3300010410 Open in IMG/M |
| Scaffold ID | Ga0136992_10043036 Open in IMG/M |
| Source Dataset Name | Aquatic microbial communities from North Sea petroleum storage tank - Cell4b |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Shell Corporation |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 754 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Aquatic → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Sea | |||||||
| Coordinates | Lat. (o) | 60.9 | Long. (o) | 1.8 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029294 | Metagenome | 189 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136992_100430361 | F029294 | N/A | LRRIDMVQETGETRDAIIEDDNKRIQKIINANKSLTDLYWIVVFAKPSKFELEGKPTLIKHIKAYKTKPPPQVGMIVGEVANSNGTVNWDVNMPQRPFDFDALQIYGAKPCNEVITETTSIPGAYITK* |
| ⦗Top⦘ |