| Basic Information | |
|---|---|
| Taxon OID | 3300010408 Open in IMG/M |
| Scaffold ID | Ga0137020_113031 Open in IMG/M |
| Source Dataset Name | Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - End of the channel, sample P5-2012 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Illumina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 511 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Microbial Communities From Soil Contaminated With Neutral Mine Drainage From Mine ??Rea In Canaa Dos Carajas, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canaa dos Carajas, PA, Brazil | |||||||
| Coordinates | Lat. (o) | -6.42916667 | Long. (o) | -50.06611111 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061095 | Metagenome | 132 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137020_1130311 | F061095 | N/A | GDADGVANRVLGAMANSRIARFAAGEKVTVLVGSKAGEHASVEHVVWSERDRCHYFYLEQPGRKLSRGYRADELADGMGDTLG* |
| ⦗Top⦘ |