NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134122_13178554

Scaffold Ga0134122_13178554


Overview

Basic Information
Taxon OID3300010400 Open in IMG/M
Scaffold IDGa0134122_13178554 Open in IMG/M
Source Dataset NameTerrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)514
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil → Terrestrial Soil Microbial Communities With And Without Nitrogen Fertilizer From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Kellog Biological Station, Michigan
CoordinatesLat. (o)42.3938Long. (o)-85.3708Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082755Metagenome113N

Sequences

Protein IDFamilyRBSSequence
Ga0134122_131785542F082755N/AFLVPGVARPTQPPANWTFEGCWTQFSAGPCRDVYRDQNGDAWICKGCGTTGNPGPGKCNRISQATLNSGFWCS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.