NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126383_10728132

Scaffold Ga0126383_10728132


Overview

Basic Information
Taxon OID3300010398 Open in IMG/M
Scaffold IDGa0126383_10728132 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama - MetaG Plot_35
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1071
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009244Metagenome / Metatranscriptome321Y
F085425Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0126383_107281321F085425GGAGMLQGVLVDEAIELLFQLTRDFGRSTGAWAIPQALGPLLRKALHPFPQGRIRQMEGGGDGGDVLTRDHRMDGLCTAKDPCLLGLLEDGC*
Ga0126383_107281322F009244N/AVELSRARHRLSPANRCPTRSRKCARGIKKNTLSYCRPTGRLDPTPADLAYGSLELAALEYRARRGDIILLYEDETVLWRFALPRLGWWRRAQRYRLPTRPLSQSQIRREESLKRQAWLGYRSWSRITSGVLLNVIGAVQYGTARVLYKIAPHFDAQEFRQYLHQVMHVFGKT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.