NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126383_10622377

Scaffold Ga0126383_10622377


Overview

Basic Information
Taxon OID3300010398 Open in IMG/M
Scaffold IDGa0126383_10622377 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama - MetaG Plot_35
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1153
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020800Metagenome / Metatranscriptome222N
F021599Metagenome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0126383_106223771F020800N/AMCSVVARVRPGARRSIVRRLTAAVMAVMAAALLAGCGGASGGVSPNASEHGQQVKGLAGGQVAALPSGNLFVRVIGFSQEPMTEFRSHKHTPGFVYVAAGVQRLQSPPAPPRIIRPGEAFFQPSVLHTHANPSTIRPNCWYFIALWPAAERRAPLVSSAASVIYESPDLDPSTMPPGPRIETLRLVT
Ga0126383_106223772F021599GGAGGMKRIIIIIIGGFLLLTPLTLVGVARATTPSSVTSTTLGRISLGPYHETSAGFKLFSKDPTDTVVLTTTINPGGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.