| Basic Information | |
|---|---|
| Taxon OID | 3300010396 Open in IMG/M |
| Scaffold ID | Ga0134126_10102475 Open in IMG/M |
| Source Dataset Name | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3517 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil → Terrestrial Soil Microbial Communities With And Without Nitrogen Fertilizer From Kellogg Biological Station, Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Kellog Biological Station, Michigan | |||||||
| Coordinates | Lat. (o) | 42.3938 | Long. (o) | -85.3708 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087516 | Metagenome / Metatranscriptome | 110 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134126_101024755 | F087516 | GGAG | VKYTLLVAAIFVFGLANAAGQVKVLTNDPLTDLPLIPATVVTKNAGNEPVKMPGGQVCKSKMQANFYSLYNYFSKNNVKVSNAIAWYSSHLSGFNKVSGYESRRSQTAFYNSDRTIVIIVTGNPGAAGEDTDAYSVAYERYQPGISEKTIAGLTQGKMVCPN* |
| ⦗Top⦘ |