NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0058701_10099778

Scaffold Ga0058701_10099778


Overview

Basic Information
Taxon OID3300010395 Open in IMG/M
Scaffold IDGa0058701_10099778 Open in IMG/M
Source Dataset NameAgave microbial communities from Guanajuato, Mexico - Or.Ma.e
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2246
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location NameGuanajuato, Mexico
CoordinatesLat. (o)21.0936Long. (o)-100.2988Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062388Metagenome130N

Sequences

Protein IDFamilyRBSSequence
Ga0058701_100997782F062388GAGMFVERMEVLEYRQKFEVELSTFPDSTNTKTPRKLVFSLTCVCLSVCQSVCLSV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.