Basic Information | |
---|---|
Taxon OID | 3300010394 Open in IMG/M |
Scaffold ID | Ga0126341_1234604 Open in IMG/M |
Source Dataset Name | Coral microbial communities from Florida Keys, Florida, USA - Orbicella T D metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 508 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Florida Keys, Florida, USA | |||||||
Coordinates | Lat. (o) | 24.6669 | Long. (o) | -81.5441 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003577 | Metagenome / Metatranscriptome | 478 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0126341_12346041 | F003577 | N/A | KSRCAKRGVGYGFRFKVKYGYISANNLESEGSTSFAVSISMETKAISS* |
⦗Top⦘ |