| Basic Information | |
|---|---|
| Taxon OID | 3300010394 Open in IMG/M |
| Scaffold ID | Ga0126341_1234084 Open in IMG/M |
| Source Dataset Name | Coral microbial communities from Florida Keys, Florida, USA - Orbicella T D metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 509 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Florida Keys, Florida, USA | |||||||
| Coordinates | Lat. (o) | 24.6669 | Long. (o) | -81.5441 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024251 | Metagenome / Metatranscriptome | 206 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0126341_12340841 | F024251 | GAG | MTQAPNKCGWLMRGRKESYGLSEAIQSLPPELREMILKECIAIKIKEKKEMGWGKVHESILKLPFCKFKQRIVQMVICFNYANCYFKRCFPCFENEGTVHNTSIRLDPNILIEADPDYKNFLEVCSWDGYNWHEWFLF |
| ⦗Top⦘ |