Scaffold Ga0118731_112209242

Overview

Basic Information

• Taxon OID: 3300010392
• Scaffold ID: Ga0118731_112209242
• Source Dataset Name: Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: JGI facility at Oak Ridge National Laboratory, Brown University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1767
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Coastal Sediment Microbial Communities From Rhode Island, Usa

Source Dataset Sampling Location

• Location Name: Rhode Island
• Coordinates
  • Lat. (^o): 40.435
  • Long. (^o): -70.483
  • Depth (m): 78

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010570	Metagenome / Metatranscriptome	302	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118731_1122092422	F010570	N/A	GTETTPEGDVVPNHPHAIVHLGNLVEVAGTYNDEGEELTAPVMSSSYHIDVLWDGEPVEAWDSAMVWCAPLGLHSFGSSSAIAEWTEACKALHPEFFPEPSEDLI*