NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118731_102917315

Scaffold Ga0118731_102917315


Overview

Basic Information
Taxon OID3300010392 Open in IMG/M
Scaffold IDGa0118731_102917315 Open in IMG/M
Source Dataset NameCoastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJGI facility at Oak Ridge National Laboratory, Brown University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)751
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Coastal Sediment Microbial Communities From Rhode Island, Usa

Source Dataset Sampling Location
Location NameRhode Island
CoordinatesLat. (o)40.435Long. (o)-70.483Alt. (m)Depth (m)78
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029776Metagenome / Metatranscriptome187N

Sequences

Protein IDFamilyRBSSequence
Ga0118731_1029173152F029776N/AMNTFKPLIAQTKPMSHLASLEELQSNRLKDNYVEHPEDRKYQAVEKAVLEEGLLNPIRVNRKDMVIITGNQRSWFAKKHGYTHISAEFVE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.