Scaffold Ga0136847_10061358

Overview

Basic Information

• Taxon OID: 3300010391
• Scaffold ID: Ga0136847_10061358
• Source Dataset Name: Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota - Twin Cities
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2629
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment → Lake Superior Sediments

Source Dataset Sampling Location

• Location Name: Lake Superior, USA
• Coordinates
  • Lat. (^o): 47.1675
  • Long. (^o): -89.65985
  • Depth (m): 190

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003259	Metagenome / Metatranscriptome	497	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136847_100613583	F003259	AGGA	MNDRRFSILLIKTVLPIMLCGFAGAASGKSEVKGAAILDHPCGKVAVKQMGLVHAGKFDEANKLSTKEMQGRWKAMPAKDRSVMSGMMKDMSETAEQFTAGIKANGLLVVDGQSATLTVQKKTKDASGTSTSTTTQALKLNGGECLVSR*