| Basic Information | |
|---|---|
| Taxon OID | 3300010389 Open in IMG/M |
| Scaffold ID | Ga0136549_10074582 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1664 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baltimore Canyon, US Atlantic Margin | |||||||
| Coordinates | Lat. (o) | 38.05018333 | Long. (o) | -73.82193333 | Alt. (m) | Depth (m) | .12 to .14 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059917 | Metagenome / Metatranscriptome | 133 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136549_100745823 | F059917 | GAG | MSLAPRVEVKVGPYFDILEVAMAEQNIELAETMLSRISPYFHLLDDEHKDYYHGCQYAIEENIVHCFAGDEDAYDEPTEYDEWQSYDSD |
| ⦗Top⦘ |