Scaffold Ga0136549_10011806

Overview

Basic Information

• Taxon OID: 3300010389
• Scaffold ID: Ga0136549_10011806
• Source Dataset Name: Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5768
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location

• Location Name: Baltimore Canyon, US Atlantic Margin
• Coordinates
  • Lat. (^o): 38.05018333
  • Long. (^o): -73.82193333
  • Depth (m): .12 to .14

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022611	Metagenome / Metatranscriptome	213	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136549_100118062	F022611	GAG	MFGLPERQPFNYGPYKLWPCFSKPEFQWFSAIDGKPCYFKSLNEAKLFIKDLVSNEDPENLCD*