NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136549_10000497

Scaffold Ga0136549_10000497


Overview

Basic Information
Taxon OID3300010389 Open in IMG/M
Scaffold IDGa0136549_10000497 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)28491
Total Scaffold Genes53 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)42 (79.25%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location
Location NameBaltimore Canyon, US Atlantic Margin
CoordinatesLat. (o)38.05018333Long. (o)-73.82193333Alt. (m)Depth (m).12 to .14
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004789Metagenome / Metatranscriptome423Y
F007028Metagenome / Metatranscriptome359Y
F012571Metagenome279Y
F026542Metagenome / Metatranscriptome197Y

Sequences

Protein IDFamilyRBSSequence
Ga0136549_1000049715F012571AGGAGGMPSIENPDDVIGVCSECHSDQPDSYMYNSPFAQEGKPVPCKYCGGVVIITYRETRNSALKDSDGGRGI*
Ga0136549_1000049717F004789GGAGMAANGTYVNPSTKHCWTFCKSCNRCADKGKYAKCADCSGRYDPAGKIDAHPDDFCDCKNGVLRWRTQQGRLIITRFNSNPFKGEVHYQKKSEDERDWDSYVSDMREKMDDPNWNPITIYEE*
Ga0136549_1000049724F026542GGAGMNTPSLEKLRELLIEFLGPQLSEVIQAYSSMDEQNRYFVEIPEHDTVDMGFETIASLVARTSNVYGRAARFAGMARAQFKILQGDYNRVYKANKIGRNDAEREASAISAAESEYSAMVTCESIVHLAEAIEVSARIASESARKLMDKMQSMQMATYREERGFYNSSDFSTY*
Ga0136549_1000049728F007028N/AMPKIVPSAFEQSDNHSIEKVVQVLSSEVSISTNPVFICGVNRKINIGNFENIDVYAGITLPLSDVSLDDKEALQAAVEEAAAYGFGIVSKETGERYLLIKESQQGS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.