NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136551_1008745

Scaffold Ga0136551_1008745


Overview

Basic Information
Taxon OID3300010388 Open in IMG/M
Scaffold IDGa0136551_1008745 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2156
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland

Source Dataset Sampling Location
Location NameJussy, Geneva, SWITZERLAND
CoordinatesLat. (o)46.25Long. (o)6.28Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030433Metagenome / Metatranscriptome185Y

Sequences

Protein IDFamilyRBSSequence
Ga0136551_10087457F030433N/AKINYMAKSLFDKAKKAAPAKTTKAKEQKVRLTVEDANFFTNVQKLEELQDQMKAAKAKADMISDEIRDVAKEAWLAQYETTGKNPESVMVVQENGEDVAQLMFVPTDKYITITEDRAEELRETYGDEIVTEDTTFGFDATMIEKYGEILSRLIEESTEIDEKDKEKIITAKTTYAVAKGTIDKFTQYGNVNEVMDDVKPVVALKNVEIIKG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.