Basic Information | |
---|---|
Taxon OID | 3300010386 Open in IMG/M |
Scaffold ID | Ga0136806_1397355 Open in IMG/M |
Source Dataset Name | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 kmer 63 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Xcelris labs Ltd |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1173 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment → Acid Mine Drainage Microbial Communities From Malanjkhand Copper Mine, India |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Malanjkhand, India | |||||||
Coordinates | Lat. (o) | 21.9985 | Long. (o) | 80.697983 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F086517 | Metagenome / Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136806_13973552 | F086517 | N/A | XKGLGHALISEAFRITLRVANEVGCRCIITDAYPDRTGWYAEYGFVPIEGAAKGGPQRMFLDIRTIRAALQAGFGQR* |
⦗Top⦘ |