Scaffold Ga0136806_1233518

Overview

Basic Information

• Taxon OID: 3300010386
• Scaffold ID: Ga0136806_1233518
• Source Dataset Name: Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 kmer 63
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Xcelris labs Ltd
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2143
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment → Acid Mine Drainage Microbial Communities From Malanjkhand Copper Mine, India

Source Dataset Sampling Location

• Location Name: Malanjkhand, India
• Coordinates
  • Lat. (^o): 21.9985
  • Long. (^o): 80.697983

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028967	Metagenome / Metatranscriptome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136806_12335183	F028967	GGA	VVPYSEGVRTSNQDNRKLVVESVAFGLGYTAVLIWAGAALVASLSGGEAAPYWPAIPHLRTDTTGIIAFTLAIISLTASKYLQLSRGDGPVEPTARSPRVLAVQAVAETAVILSTGLVAYLSLNAVTHPVTLQMQLTHLLPWPSEGTVRVIALGICLAAVATRRYLRATASRPSQTAAVRENGGGADRTARLVGVPLDDHRPGEL*