Scaffold Ga0136806_1202817

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136806_1202817

Scaffold Ga0136806_1202817

Overview

Basic Information
Taxon OID	3300010386 Open in IMG/M
Scaffold ID	Ga0136806_1202817 Open in IMG/M
Source Dataset Name	Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 kmer 63
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Xcelris labs Ltd
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2822
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment → Acid Mine Drainage Microbial Communities From Malanjkhand Copper Mine, India

Source Dataset Sampling Location
Location Name	Malanjkhand, India
Coordinates	Lat. (^o)	21.9985	Long. (^o)	80.697983	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024620	Metagenome / Metatranscriptome	205	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136806_12028173	F024620	N/A	MTHPGPAAHLFGEVPGADRLLGRSQAELADAMTWLAWYAPGTFTAVMDYMDAVDGELVPAAT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.