| Basic Information | |
|---|---|
| Taxon OID | 3300010386 Open in IMG/M |
| Scaffold ID | Ga0136806_1112655 Open in IMG/M |
| Source Dataset Name | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 kmer 63 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Xcelris labs Ltd |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 981 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment → Acid Mine Drainage Microbial Communities From Malanjkhand Copper Mine, India |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Malanjkhand, India | |||||||
| Coordinates | Lat. (o) | 21.9985 | Long. (o) | 80.697983 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002998 | Metagenome / Metatranscriptome | 514 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136806_11126552 | F002998 | GAGG | MSVSANRIWRQMPEEIRIAASKVFWAEPKGARKQIVFASLAKAKNLREVTVRKAPIERLVNWTAGTLSLPDQIVDELLKDYLLHAHRTVIVSFLELLKIPHDNGMINESFGLATLSDEQVQKAARSLLGSADRMGAVLYLKYLVLQGGPWSAVEEVLAAEE* |
| ⦗Top⦘ |