Scaffold Ga0126328_10266360

Overview

Basic Information

• Taxon OID: 3300010377
• Scaffold ID: Ga0126328_10266360
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 770
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Hawaii, USA
• Coordinates
  • Lat. (^o): 21.2608
  • Long. (^o): -157.7866
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055336	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126328_102663602	F055336	AGTAG	VLAHLDELGPAFEIGLQPAEQYFHHSELELQAIEEELVVDGVEANQDSDLLVVVRREDTVQDI*