Scaffold Ga0134125_10348753

Overview

Basic Information

• Taxon OID: 3300010371
• Scaffold ID: Ga0134125_10348753
• Source Dataset Name: Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1642
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil → Terrestrial Soil Microbial Communities With And Without Nitrogen Fertilizer From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Kellog Biological Station, Michigan
• Coordinates
  • Lat. (^o): 42.3938
  • Long. (^o): -85.3708

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035472	Metagenome / Metatranscriptome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134125_103487532	F035472	N/A	MNRSIRIPLLSLGAALALVVLGACGSELSAYGDACSVYAVENDCESPNQCMCRVNAPYCVCSHRCEQDKDCPGGSVCLPGQNPANNQQDLFCFKGDGGTP*