| Basic Information | |
|---|---|
| Taxon OID | 3300010369 Open in IMG/M |
| Scaffold ID | Ga0136643_10104756 Open in IMG/M |
| Source Dataset Name | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3592 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Petit - Saut dam, French Guiana | |||||||
| Coordinates | Lat. (o) | 5.0626 | Long. (o) | -53.0462 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001661 | Metagenome | 655 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136643_101047565 | F001661 | N/A | SGPSLGTRAKFMTFNRTQSRAVTGLLTGHNTLRRHLYLLGLLDSPLCRKCRVGEETSAHILCECEALASLRHAYLDSIFLEPEDIRSLGLGVTWNYSKVAGLPRFDMGHKMPVLIKA* |
| ⦗Top⦘ |