Basic Information | |
---|---|
Taxon OID | 3300010366 Open in IMG/M |
Scaffold ID | Ga0126379_10526818 Open in IMG/M |
Source Dataset Name | Tropical forest soil microbial communities from Panama - MetaG Plot_24 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1258 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Panama | |||||||
Coordinates | Lat. (o) | 9.1086 | Long. (o) | -79.8436 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005829 | Metagenome / Metatranscriptome | 389 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0126379_105268181 | F005829 | N/A | MKSSDKQATAELLAALVEVAIARGCRHYSESGEPLATTLAVLECLQRDGFVTVEEPARRGSAPAAGTP* |
⦗Top⦘ |